PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_03433.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 289aa    MW: 33001.5 Da    PI: 5.8731
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_03433.1_g00002.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.33.4e-102212581954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              F+   ++yps +e+  LA+++gL+++qV++WF N R +
  Rsa1.0_03433.1_g00002.1 221 FHHflHPYPSDAEKLMLASQTGLSKNQVSNWFINARVR 258
                              554459******************************98 PP

2BELL102.82.4e-3381152172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              e++el++k++kLlsll++Vd+r+  y++ql++vissFe+vag gs+k+Yt lAl+a++rhF +L++ai +q+
  Rsa1.0_03433.1_g00002.1  81 ENHELHIKITKLLSLLQQVDERFDIYCNQLEQVISSFEEVAGEGSSKLYTGLALQAMTRHFGSLQEAILSQL 152
                              689******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.2E-1411150IPR006563POX domain
PfamPF075261.9E-2919148IPR006563POX domain
SMARTSM003892.3E-10202266IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-27207268IPR009057Homeodomain-like
CDDcd000866.34E-12208263No hitNo description
SuperFamilySSF466893.89E-18208271IPR009057Homeodomain-like
PfamPF059205.2E-18219258IPR008422Homeobox KN domain
PROSITE profilePS5007111.936221262IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MEEFRVRHEF SSPTSVPLDS RYVKAVRCLL EEVIDIGGRE VDLCNDVLIQ QLFPGRRRPG  60
FGLSSEIRSE LCNSGFMSLP ENHELHIKIT KLLSLLQQVD ERFDIYCNQL EQVISSFEEV  120
AGEGSSKLYT GLALQAMTRH FGSLQEAILS QLNSLRRRFI ISQDFVPKIT TSGLSQLSLF  180
DGNTPSSLQL LGWVQGPQRH AWKPIRGLPE TSVAILRAWL FHHFLHPYPS DAEKLMLASQ  240
TGLSKNQVSN WFINARVRLW KPMIEEMYRE EFGDSSDESM QREGNDDSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-17208269566Homeobox protein Meis2
3k2a_B2e-17208269566Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013710381.10.0PREDICTED: BEL1-like homeodomain protein 11
RefseqXP_013710380.10.0PREDICTED: BEL1-like homeodomain protein 11
RefseqXP_013649902.10.0PREDICTED: BEL1-like homeodomain protein 11
RefseqXP_013649901.10.0PREDICTED: BEL1-like homeodomain protein 11
SwissprotQ1PFD10.0BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLA0A078IEG80.0A0A078IEG8_BRANA; BnaAnng09210D protein
STRINGBra015844.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM97362734
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.10.0BEL1-like homeodomain 11